Kliniske studier

Kunstig intelligens hjelper forskerne forstå mer av MS-pasienters immunsystem

Multippel sklerose eller MS er en nevrologisk sykdom som angriper sentralnervesystemet. Per dags dato vet vi at immunsystemet er en viktig bit av puslespillet MS, fordi det er nettopp celler i immunsystemet som angriper hjerne og ryggmarg. Problemet er at vi ikke vet hvorfor. Men forskerne ved Akershus Universitetssykehus har kommet opp med en ny hypotese, og de bruker kunstig intelligens for å teste om den stemmer.

Publisert

I dag har omtrent 13.000 MS i Norge. Sykdommene er alvorlig i den grad at den kan gi stort funksjonstap og i verste fall tidlig død.

Ny hypotese

I immunsystemet vårt er det flere typer celler, men spesielt to celletyper er sentrale i forskningen rundt MS.

-De mest vesentlige er de vi kaller B-celler og T-celler. Dette er celler som er essensielle komponenter av vårt tilpasningsdyktige immunforsvar.

Det sier postdoktor Rune Alexander Høglund som har dette som sitt doktorgradsprosjekt. Han er sammen med overlege og professor Trygve Holmøy ved Akershus Universitetssykehus (Ahus) og Universitetet i Oslo (UiO) en av hovedforskerne bak prosjektet

-Vi tror at det er B- og T-cellene som fremkaller og driver sykdommen, problemet er at vi ikke vet hvordan og hva som trigger de. Dette er celler som normalt er tett involvert i kroppens respons mot virus og bakterier.

Når virus og bakterier angriper kroppen, er det spesifikke B- og T-celler som aktiveres for å drepe inntrengeren.

-Men i MS vet vi ikke hva de angriper. De er der, de angriper noe og forårsaker en betennelseskaskade, men vi vet ikke hvorfor.

En vanlig hypotese ved MS er at B- og T-cellene reagerer feil på et protein i hjernen, og angriper det som om det var et virus. Forskerne ved Ahus mener derimot at immunforsvaret angriper seg selv.

- Vår hypotese er at T-cellene kjenner igjen noe i B-cellene og setter i gang en betennelsesreaksjon basert på hverandre, forklarer Høglund

HealthTalk møtte med Høglund på Ahus for å snakke med han om studien

-Vi tror at det er B- og T-cellene som fremkaller og driver sykdommen, problemet er at vi ikke vet hvordan og hva som trigger de. Dette er celler som normalt er tett involvert i kroppens respons mot virus og bakterier.

Når virus og bakterier angriper kroppen, er det spesifikke B- og T-celler som aktiveres for å drepe inntrengeren.

-Men i MS vet vi ikke hva de angriper. De er der, de angriper noe og forårsaker en betennelseskaskade, men vi vet ikke hvorfor.

En vanlig hypotese ved MS er at B- og T-cellene reagerer feil på et protein i hjernen, og angriper det som om det var et virus. Forskerne ved Ahus mener derimot at immunforsvaret angriper seg selv.

- Vår hypotese er at T-cellene kjenner igjen noe i B-cellene og setter i gang en betennelsesreaksjon basert på hverandre, forklarer Høglund

Vanskelig å bevise i labben

For å sjekke om hypotesen deres fungerte måtte forskerne først få tak i pasientenes B- og T-celler.

-Det vi gjorde var å samle materiale fra MS-pasienter, og vi ville gjerne komme oss nærmest mulig hjernen. Det er ikke mulig å ta vevsprøver fra relativt friske MS-pasienter, så løsningen ble spinalvæske. Vii hentet det ut fra ryggmargen ved å bruke en nål. Vi tok også en blodprøve fra pasientene for å se nærmere på B-cellene.

Problemet forskerne støtte på er at i menneskes immunsystem finnes det milliarder av forskjellige T- og B-celler, i tillegg til alle de andre cellene. Derfor er det vanskelig å teste dette i et laboratorium. Å finne de eksakte cellene som var relevante for forskernes hypotese ble litt som å finne nåla i høystakken.

-Så da ble svaret kunstig intelligens - AI - for å kunne begrense dette til et fåtall celler vi kan teste i laboratoriet.

Derfor ble cellene forskerne hentet fra blod og spinalvæsken lagt det inn i et datasystem. Resultatet var tusenvis av frekvenser som kan se litt ut som dette

SVDTSKNQFSLTVTSVTAADTAVYYCARGLRFPSYWFDPWGQG

Sjekket i prediksjonsmodellen

Disse frekvensene blir så kjørt gjennom prediksjonsmodellen deres.

Det prediksjonsmodellen gjør er å ta hver enkelt bit fra cellene som potensielt kan fremkalle sykdom og prøver å fortelle forskerne hvor sannsynlig det er at forskjellige ting skjer. Den produserer så en massiv tabell, med millioner av rekker som må analyseres og sorteres hvor sluttresultatet blir en datafigur. Rett og slett en samlet prediksjon som forteller om hvorvidt disse T og B cellene aktiverer hverandre.

Lette etter og fant et mønster

Da de startet denne studien ville forskerne se på det helt overordnet, så de analyserte alle sekvensene fra MS-pasientene mens de lette etter et mønster i cellene de hadde høstet inn. Spørsmålet var om det var noen spesielle strukturer eller områder i proteinet som mer sannsynlig kan fremkalle immunresponser? Og det fant de.

-Men når vi gjør dette i en datamaskin så må vi gå utifra at maskinen kan ta feil. Så vi var nødt til å teste det.

Resten av prosjektene har derfor har gått ut på å teste om dette er sant.

-Så da har vi testet forskjellige biter fra B-cellene. Først testet vi hvorvidt den kunstige intelligensen mer eller mindre korrekt klarer å forutsi om disse fragmentene dannes, kan disse fragmentene faktisk skapes og skjer det gjennom proteinnedbrytning?

Der fant de gode resultater, altså datamaskinen klarer å forutsi med en viss sannsynlighet at disse fragmentene dannes. Videre har forskerne testet om disse fragmentene kan stimulere T-celler, altså om biter av B-celler stimulerer T-celler.

-Det var den siste studien i dette prosjektet. Der blandet vi rett og slett T-cellene med disse bitene fra B cellene som datamodellen hadde fortalt oss ville fremkalle sykdom, og så om disse T-cellene responderte. Noe de gjorde. Ikke i alle tilfellene fordi maskiner har ikke alltid rett, men i nok tilfeller til at jeg tror denne modellen kan hjelpe oss videre.

Veien videre

Forskerne har bevist at de har en modell som kan sortere ut de mest relevante bitene i puslespillet, og at disse bitene som prediksjonsmodellen har løftet frem kan aktivere T-celler. Så veien videre nå må være å teste om dette er bare er tilfellet hos MS-pasienter,forteller Høglund

-Vi må derfor sammenligne med andre sykdommer og se om vi kan finne disse cellene både i blod og spinalvæske til flere MS-pasienter. Denne studien inkluderte ganske få pasienter så vi vil gjerne teste flere. Vi vil gjerne bekrefte om det er noe spesielt med disse T-cellene som reagerer. Derfor er det mange veier videre herfra.

Powered by Labrador CMS